SCOPe 2.07: Domain d3b76a1: 3b76 A:408-502

Lineage for d3b76a1 (3b76 A:408-502)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d3b76a1: 3b76 A:408-502 [231833]
   Other proteins in same PDB: d3b76a2, d3b76b2
   automated match to d2vrfa_
   complexed with edo, na

Details for d3b76a1

PDB Entry: 3b76, 1.75 Å

PDB Description: crystal structure of the third pdz domain of human ligand-of-numb protein-x (lnx1) in complex with the c-terminal peptide from the coxsackievirus and adenovirus receptor

PDB Compounds: (A:) E3 ubiquitin-protein ligase LNX

SCOPe Domain Sequences for d3b76a1:

Sequence; same for both SEQRES and ATOM records:

>d3b76a1 b.36.1.0 (A:408-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hekvvniqkdpgeslgmtvaggashrewdlpiyvisvepggvisrdgriktgdillnvdg
veltevsrseavallkrtsssivlkalevkegsiv

Timeline for d3b76a1:

• d3b76a1 first appeared in SCOPe 2.03, called d3b76a_
  
• d3b76a1 appears in SCOPe 2.06
  
• d3b76a1 appears in the current release, SCOPe 2.08