SCOPe 2.07: Domain d3av7a_: 3av7 A:

Lineage for d3av7a_ (3av7 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries)

8. Domain d3av7a_: 3av7 A: [231812]
   automated match to d3aova_
   complexed with kya, kyn, pmp

Details for d3av7a_

PDB Entry: 3av7, 1.84 Å

PDB Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PMP, KYN as substrates and KYA as products

PDB Compounds: (A:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3av7a_:

Sequence; same for both SEQRES and ATOM records:

>d3av7a_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

Timeline for d3av7a_:

• d3av7a_ first appeared in SCOPe 2.03
  
• d3av7a_ appears in SCOPe 2.06
  
• d3av7a_ appears in the current release, SCOPe 2.08