SCOPe 2.08: Domain d3afha2: 3afh A:316-486

Lineage for d3afha2 (3afh A:316-486)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.0: automated matches [227179] (1 protein)
   not a true family

6. Protein automated matches [226898] (7 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [225199] (2 PDB entries)

8. Domain d3afha2: 3afh A:316-486 [231790]
   Other proteins in same PDB: d3afha1
   automated match to d4gria2
   protein/RNA complex; complexed with gsu

Details for d3afha2

PDB Entry: 3afh, 2 Å

PDB Description: Crystal structure of Thermotoga maritima nondiscriminating glutamyl-tRNA synthetase in complex with a glutamyl-AMP analog

PDB Compounds: (A:) Glutamyl-tRNA synthetase 2

SCOPe Domain Sequences for d3afha2:

Sequence; same for both SEQRES and ATOM records:

>d3afha2 a.97.1.0 (A:316-486) automated matches {Thermotoga maritima [TaxId: 2336]}
dyqklewvngkhmrridledlkrefiewakyagkeipsvderyfsetlricrekvntlsq
lydimypfmnddyeyekdyvekflkreeaervleeakkafkdlnswnmeeiektlrdlse
kglaskkvvfqlirgavtgklvtpglfetievlgkertlkrlertlqflkk

Timeline for d3afha2:

• d3afha2 first appeared in SCOPe 2.03
  
• d3afha2 appears in SCOPe 2.07