SCOPe 2.03: Domain d3afha1: 3afh A:24-315

Lineage for d3afha1 (3afh A:24-315)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [225198] (2 PDB entries)

8. Domain d3afha1: 3afh A:24-315 [231789]
   Other proteins in same PDB: d3afha2
   automated match to d4gria1
   protein/RNA complex; complexed with gsu

Details for d3afha1

PDB Entry: 3afh, 2 Å

PDB Description: Crystal structure of Thermotoga maritima nondiscriminating glutamyl-tRNA synthetase in complex with a glutamyl-AMP analog

PDB Compounds: (A:) Glutamyl-tRNA synthetase 2

SCOPe Domain Sequences for d3afha1:

Sequence; same for both SEQRES and ATOM records:

>d3afha1 c.26.1.0 (A:24-315) automated matches {Thermotoga maritima [TaxId: 2336]}
lvrvrfapsptghlhvggartalfnwmfarkeggkfilriedtdterssreyeqqilesl
rwcgldwdegpdiggdfgpyrqserleiyreyaeklvedkrayyvvydkedpskelftty
eypheykekghpvtikfkvlpgktsfedllkgymefdnstledfiimksngfptynfavv
vddhlmrishvfrgedhlsntpkqlmiyeafgweapvfmhiplilgsdrtplskrhgats
vehfrregilsralmnylallgwrvegdeiftieeklqsfdpkdisnkgvif

Timeline for d3afha1:

• d3afha1 is new in SCOPe 2.03-stable
  
• d3afha1 appears in SCOPe 2.04
  
• d3afha1 appears in the current release, SCOPe 2.08