SCOPe 2.04: Domain d2zwzb2: 2zwz B:357-447

Lineage for d2zwzb2 (2zwz B:357-447)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (27 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [231746] (10 PDB entries)

8. Domain d2zwzb2: 2zwz B:357-447 [231751]
   Other proteins in same PDB: d2zwza1, d2zwzb1
   automated match to d1hl8a1
   complexed with zwz

Details for d2zwzb2

PDB Entry: 2zwz, 2.36 Å

PDB Description: alpha-L-fucosidase complexed with inhibitor, Core1

PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwzb2:

Sequence; same for both SEQRES and ATOM records:

>d2zwzb2 b.71.1.0 (B:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

Timeline for d2zwzb2:

• d2zwzb2 first appeared in SCOPe 2.03
  
• d2zwzb2 appears in SCOPe 2.05
  
• d2zwzb2 appears in the current release, SCOPe 2.08