Lineage for d2zwzb2 (2zwz B:357-447)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1328473Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1328474Protein automated matches [226835] (18 species)
    not a true protein
  7. 1328554Species Thermotoga maritima [TaxId:2336] [231746] (2 PDB entries)
  8. 1328556Domain d2zwzb2: 2zwz B:357-447 [231751]
    Other proteins in same PDB: d2zwza1, d2zwzb1
    automated match to d1hl8a1
    complexed with zwz

Details for d2zwzb2

PDB Entry: 2zwz (more details), 2.36 Å

PDB Description: alpha-L-fucosidase complexed with inhibitor, Core1
PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwzb2 b.71.1.0 (B:357-447) automated matches {Thermotoga maritima [TaxId: 2336]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

SCOPe Domain Coordinates for d2zwzb2:

Click to download the PDB-style file with coordinates for d2zwzb2.
(The format of our PDB-style files is described here.)

Timeline for d2zwzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zwzb1