| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins) glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases automatically mapped to Pfam PF01120 |
| Protein automated matches [231482] (2 species) not a true protein |
| Species Thermotoga maritima [TaxId:2336] [231744] (2 PDB entries) |
| Domain d2zwza1: 2zwz A:7-356 [231748] Other proteins in same PDB: d2zwza2, d2zwzb2 automated match to d1hl9a2 complexed with zwz |
PDB Entry: 2zwz (more details), 2.36 Å
SCOPe Domain Sequences for d2zwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwza1 c.1.8.11 (A:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy
Timeline for d2zwza1: