Lineage for d2zwza1 (2zwz A:7-356)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341090Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 proteins)
    glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
    automatically mapped to Pfam PF01120
  6. 1341099Protein automated matches [231482] (2 species)
    not a true protein
  7. 1341100Species Thermotoga maritima [TaxId:2336] [231744] (2 PDB entries)
  8. 1341101Domain d2zwza1: 2zwz A:7-356 [231748]
    Other proteins in same PDB: d2zwza2, d2zwzb2
    automated match to d1hl9a2
    complexed with zwz

Details for d2zwza1

PDB Entry: 2zwz (more details), 2.36 Å

PDB Description: alpha-L-fucosidase complexed with inhibitor, Core1
PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2zwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwza1 c.1.8.11 (A:7-356) automated matches {Thermotoga maritima [TaxId: 2336]}
rykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyae
wyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyviptt
khhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepir
ypedlsyirpntyeyadyaykqvmelvdlylpdvlwndmgwpekgkedlkylfayyynkh
pegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsveq
lvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

SCOPe Domain Coordinates for d2zwza1:

Click to download the PDB-style file with coordinates for d2zwza1.
(The format of our PDB-style files is described here.)

Timeline for d2zwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zwza2