Lineage for d2zvia1 (2zvi A:11-123)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2196090Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2196091Protein automated matches [226983] (18 species)
    not a true protein
  7. 2196103Species Bacillus subtilis [TaxId:1423] [231734] (1 PDB entry)
  8. 2196104Domain d2zvia1: 2zvi A:11-123 [231742]
    Other proteins in same PDB: d2zvia2, d2zvib2, d2zvic2, d2zvid2
    automated match to d4nasa1

Details for d2zvia1

PDB Entry: 2zvi (more details), 2.3 Å

PDB Description: Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
PDB Compounds: (A:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2zvia1:

Sequence, based on SEQRES records: (download)

>d2zvia1 d.58.9.0 (A:11-123) automated matches {Bacillus subtilis [TaxId: 1423]}
sellatylltepgadtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeregta
asekqavitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkral

Sequence, based on observed residues (ATOM records): (download)

>d2zvia1 d.58.9.0 (A:11-123) automated matches {Bacillus subtilis [TaxId: 1423]}
sellatylltepdtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeraasekq
avitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkral

SCOPe Domain Coordinates for d2zvia1:

Click to download the PDB-style file with coordinates for d2zvia1.
(The format of our PDB-style files is described here.)

Timeline for d2zvia1: