SCOPe 2.04: Domain d2zu0c_: 2zu0 C:

Lineage for d2zu0c_ (2zu0 C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231728] (4 PDB entries)

8. Domain d2zu0c_: 2zu0 C: [231729]
   Other proteins in same PDB: d2zu0a_, d2zu0b_
   automated match to d2d2ea_
   complexed with mes

Details for d2zu0c_

PDB Entry: 2zu0, 2.2 Å

PDB Description: Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis

PDB Compounds: (C:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d2zu0c_:

Sequence; same for both SEQRES and ATOM records:

>d2zu0c_ c.37.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
ygwlteq

Timeline for d2zu0c_:

• d2zu0c_ first appeared in SCOPe 2.03
  
• d2zu0c_ appears in SCOPe 2.05
  
• d2zu0c_ appears in the current release, SCOPe 2.08