Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Streptococcus mutans [231716] (2 PDB entries) |
Domain d2zida2: 2zid A:464-536 [231719] Other proteins in same PDB: d2zida1 automated match to d4aiea2 complexed with ca |
PDB Entry: 2zid (more details), 2.2 Å
SCOPe Domain Sequences for d2zida2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zida2 b.71.1.0 (A:464-536) automated matches {Streptococcus mutans} adfellptadkvfaylrkvreerylivvnvsdqeevleidvdkqetlisntnesaalanh klqpwdafcikil
Timeline for d2zida2: