SCOPe 2.06: Domain d2zgua_: 2zgu A:

Lineage for d2zgua_ (2zgu A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zgua_: 2zgu A: [231706]
   automated match to d1ww4a_
   mutant

Details for d2zgua_

PDB Entry: 2zgu, 2.4 Å

PDB Description: crystal structure agrocybe aegerita lectin aal mutant i144g

PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgua_:

Sequence; same for both SEQRES and ATOM records:

>d2zgua_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsgfstvveavtytgla

Timeline for d2zgua_:

• d2zgua_ first appeared in SCOPe 2.03
  
• d2zgua_ appears in SCOPe 2.05
  
• d2zgua_ appears in SCOPe 2.07
  
• d2zgua_ appears in the current release, SCOPe 2.08