Lineage for d2zgta_ (2zgt A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2051801Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 2051834Domain d2zgta_: 2zgt A: [231705]
    Other proteins in same PDB: d2zgtb2
    automated match to d1ww4a_
    mutant

Details for d2zgta_

PDB Entry: 2zgt (more details), 2.8 Å

PDB Description: crystal structure of agrocybe aegerita lectin aal mutant f93g
PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgta_:

Sequence, based on SEQRES records: (download)

>d2zgta_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqgagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

Sequence, based on observed residues (ATOM records): (download)

>d2zgta_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalpnnttlnlfaengayllhiafrlqen
viifnsrqpdgpwlveqrvsdgagidgkamvtvfdhgdkyqvvinektviqytkqisglt
sslsynattvveavtytgla

SCOPe Domain Coordinates for d2zgta_:

Click to download the PDB-style file with coordinates for d2zgta_.
(The format of our PDB-style files is described here.)

Timeline for d2zgta_: