Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (23 species) not a true protein |
Species Agrocybe aegerita [TaxId:5400] [231694] (14 PDB entries) |
Domain d2zgpa_: 2zgp A: [231700] automated match to d1ww4a_ mutant |
PDB Entry: 2zgp (more details), 2.7 Å
SCOPe Domain Sequences for d2zgpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zgpa_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]} qgvniynisagtsvdlaapvttgdgvtffssalnlnagagnpnnttlnlfaengayllhi afrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinektv iqytkqisgltsslsynateetsifstvveavtytgla
Timeline for d2zgpa_: