SCOPe 2.08: Domain d2zgoa1: 2zgo A:0-158

Lineage for d2zgoa1 (2zgo A:0-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d2zgoa1: 2zgo A:0-158 [231698]
   Other proteins in same PDB: d2zgoa2, d2zgob2
   automated match to d1ww4a_
   mutant

Details for d2zgoa1

PDB Entry: 2zgo, 2 Å

PDB Description: crystal structure of aal mutant h59q complex with lactose

PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgoa1:

Sequence; same for both SEQRES and ATOM records:

>d2zgoa1 b.29.1.0 (A:0-158) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllq
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytgla

Timeline for d2zgoa1:

• d2zgoa1 first appeared in SCOPe 2.03, called d2zgoa_
  
• d2zgoa1 appears in SCOPe 2.07