SCOPe 2.03: Domain d2zgla_: 2zgl A:

Lineage for d2zgla_ (2zgl A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (14 PDB entries)

8. Domain d2zgla_: 2zgl A: [231695]
   automated match to d1ww4a_

Details for d2zgla_

PDB Entry: 2zgl, 1.9 Å

PDB Description: Crystal structure of recombinant Agrocybe aegerita (rAAL)

PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgla_:

Sequence; same for both SEQRES and ATOM records:

>d2zgla_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssalnlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytglal

Timeline for d2zgla_:

• d2zgla_ is new in SCOPe 2.03-stable
  
• d2zgla_ appears in SCOPe 2.04
  
• d2zgla_ appears in the current release, SCOPe 2.08, called d2zgla1