Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [225504] (1 PDB entry) |
Domain d2z7eb_: 2z7e B: [231690] automated match to d2z7ea_ complexed with fes, so4 |
PDB Entry: 2z7e (more details), 2.3 Å
SCOPe Domain Sequences for d2z7eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z7eb_ d.224.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]} feynekvldhflnprnvgvledangvgqcgnpacgaamlftikvnpendviedvrfktfg cgsaiavssmltemvkgkpiqyalnltykdifeelgglppqkihctnlgletlhvaikdy lmkqgrveeaskipdcyeee
Timeline for d2z7eb_: