Lineage for d2z0oa2 (2z0o A:274-372)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071626Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2071670Domain d2z0oa2: 2z0o A:274-372 [231688]
    Other proteins in same PDB: d2z0oa1
    automated match to d2elba2

Details for d2z0oa2

PDB Entry: 2z0o (more details), 2.58 Å

PDB Description: crystal structure of appl1-bar-ph domain
PDB Compounds: (A:) DCC-interacting protein 13-alpha

SCOPe Domain Sequences for d2z0oa2:

Sequence, based on SEQRES records: (download)

>d2z0oa2 b.55.1.0 (A:274-372) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinn

Sequence, based on observed residues (ATOM records): (download)

>d2z0oa2 b.55.1.0 (A:274-372) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnardrqfyftqggnlmsqargdvagglamdidncsvmavdcedrrycfq
itsssilqaeskkdheewictinn

SCOPe Domain Coordinates for d2z0oa2:

Click to download the PDB-style file with coordinates for d2z0oa2.
(The format of our PDB-style files is described here.)

Timeline for d2z0oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z0oa1