Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [188265] (3 PDB entries) |
Domain d2ywma1: 2ywm A:1-121 [231670] automated match to d2aytb1 |
PDB Entry: 2ywm (more details), 2.3 Å
SCOPe Domain Sequences for d2ywma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywma1 c.47.1.0 (A:1-121) automated matches {Aquifex aeolicus [TaxId: 224324]} mllnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdki kldiyspfthkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrk p
Timeline for d2ywma1: