Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [231666] (3 PDB entries) |
Domain d2yvua_: 2yvu A: [231667] automated match to d2peza_ |
PDB Entry: 2yvu (more details), 2.1 Å
SCOPe Domain Sequences for d2yvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvua_ c.37.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]} kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi rrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie
Timeline for d2yvua_: