Lineage for d2yvua_ (2yvu A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128225Species Aeropyrum pernix [TaxId:272557] [231666] (3 PDB entries)
  8. 2128226Domain d2yvua_: 2yvu A: [231667]
    automated match to d2peza_

Details for d2yvua_

PDB Entry: 2yvu (more details), 2.1 Å

PDB Description: Crystal structure of APE1195
PDB Compounds: (A:) Probable adenylyl-sulfate kinase

SCOPe Domain Sequences for d2yvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvua_ c.37.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
rrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie

SCOPe Domain Coordinates for d2yvua_:

Click to download the PDB-style file with coordinates for d2yvua_.
(The format of our PDB-style files is described here.)

Timeline for d2yvua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yvub_