Lineage for d2yfha1 (2yfh A:1-195)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610015Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1610144Protein automated matches [227004] (2 species)
    not a true protein
  7. 1610145Species Clostridium symbiosum [TaxId:1512] [231613] (1 PDB entry)
  8. 1610146Domain d2yfha1: 2yfh A:1-195 [231614]
    Other proteins in same PDB: d2yfha2, d2yfhb2, d2yfhc2, d2yfhd2, d2yfhe2, d2yfhf2
    automated match to d1bgva2

Details for d2yfha1

PDB Entry: 2yfh (more details), 2.7 Å

PDB Description: structure of a chimeric glutamate dehydrogenase
PDB Compounds: (A:) glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase

SCOPe Domain Sequences for d2yfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfha1 c.58.1.1 (A:1-195) automated matches {Clostridium symbiosum [TaxId: 1512]}
mskyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervie
frvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttl
pmggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygq
yrkivggfyngvltg

SCOPe Domain Coordinates for d2yfha1:

Click to download the PDB-style file with coordinates for d2yfha1.
(The format of our PDB-style files is described here.)

Timeline for d2yfha1: