Lineage for d1djxa2 (1djx A:626-756)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107130Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 107131Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 107132Family b.7.1.1: PLC-like (P variant) [49563] (6 proteins)
  6. 107157Protein PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain [49564] (1 species)
  7. 107158Species Rat (Rattus norvegicus) [TaxId:10116] [49565] (10 PDB entries)
  8. 107161Domain d1djxa2: 1djx A:626-756 [23159]
    Other proteins in same PDB: d1djxa1, d1djxa3, d1djxb1, d1djxb3

Details for d1djxa2

PDB Entry: 1djx (more details), 2.3 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-1,4,5-trisphosphate

SCOP Domain Sequences for d1djxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djxa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus)}
wrperlrvriisgqqlpkvnknknsivdpkviveihgvgrdtgsrqtavitnngfnprwd
mefefevtvpdlalvrfmvedydssskndfigqstipwnslkqgyrhvhllskngdqhps
atlfvkisiqd

SCOP Domain Coordinates for d1djxa2:

Click to download the PDB-style file with coordinates for d1djxa2.
(The format of our PDB-style files is described here.)

Timeline for d1djxa2: