SCOPe 2.03: Domain d2xsha1: 2xsh A:18-179

Lineage for d2xsha1 (2xsh A:18-179)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (8 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [226023] (6 PDB entries)

8. Domain d2xsha1: 2xsh A:18-179 [231575]
   Other proteins in same PDB: d2xsha2, d2xshb_, d2xshc2, d2xshd_, d2xshe2, d2xshf_, d2xshg2, d2xshh_, d2xshi2, d2xshj_, d2xshk2, d2xshl_
   automated match to d2xr8c1
   complexed with dc5, fe2, fes

Details for d2xsha1

PDB Entry: 2xsh, 2.29 Å

PDB Description: crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl

PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d2xsha1:

Sequence, based on SEQRES records:

>d2xsha1 b.33.1.0 (A:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq

Sequence, based on observed residues (ATOM records):

>d2xsha1 b.33.1.0 (A:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq

Timeline for d2xsha1:

• d2xsha1 is new in SCOPe 2.03-stable
  
• d2xsha1 appears in SCOPe 2.04
  
• d2xsha1 appears in the current release, SCOPe 2.08