SCOPe 2.03: Domain d2x6ca2: 2x6c A:138-299

Lineage for d2x6ca2 (2x6c A:138-299)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (22 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [231564] (1 PDB entry)

8. Domain d2x6ca2: 2x6c A:138-299 [231565]
   Other proteins in same PDB: d2x6ca1
   automated match to d1p7ba1
   complexed with cl, k, pc, sm

Details for d2x6ca2

PDB Entry: 2x6c, 2.7 Å

PDB Description: Potassium Channel from Magnetospirillum Magnetotacticum

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6ca2:

Sequence; same for both SEQRES and ATOM records:

>d2x6ca2 b.1.18.0 (A:138-299) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
ptagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrseisqegmvfrrfhd
ltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvhar
hayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh

Timeline for d2x6ca2:

• d2x6ca2 is new in SCOPe 2.03-stable
  
• d2x6ca2 appears in SCOPe 2.04
  
• d2x6ca2 appears in the current release, SCOPe 2.08