SCOPe 2.08: Domain d2x6ca1: 2x6c A:12-137

Lineage for d2x6ca1 (2x6c A:12-137)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.0: automated matches [231560] (1 protein)
   not a true family

6. Protein automated matches [231561] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [231562] (2 PDB entries)

8. Domain d2x6ca1: 2x6c A:12-137 [231563]
   Other proteins in same PDB: d2x6ca2, d2x6ca3
   automated match to d1p7ba2
   complexed with cl, k, pc, sm

Details for d2x6ca1

PDB Entry: 2x6c, 2.7 Å

PDB Description: Potassium Channel from Magnetospirillum Magnetotacticum

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6ca1:

Sequence, based on SEQRES records:

>d2x6ca1 f.14.1.0 (A:12-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli
yarftr

Sequence, based on observed residues (ATOM records):

>d2x6ca1 f.14.1.0 (A:12-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlghyhdlltvswpvfitlitglylvtnalfalaylagdvienafff
svqtmatigygkliptlvtlealcgmlglavaasliyarftr

Timeline for d2x6ca1:

• d2x6ca1 first appeared in SCOPe 2.03
  
• d2x6ca1 appears in SCOPe 2.07