Lineage for d1kcw_6 (1kcw 892-1040)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) 
Protein Ceruloplasmin [49559] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry) 
Domain d1kcw_6: 1kcw 892-1040 [23156]
Details for d1kcw_6
PDB Entry: 1kcw (more details), 3 Å
PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms
SCOP Domain Sequences for d1kcw_6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcw_6 b.6.1.3 (892-1040) Ceruloplasmin {Human (Homo sapiens)}
rrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlq
gltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfp
rtpgiwllhchvtdhihagmettytvlqn
SCOP Domain Coordinates for d1kcw_6:
Click to download the PDB-style file with coordinates for d1kcw_6.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kcw_6:
- d1kcw_6 appears in SCOP 1.57
- d1kcw_6 appears in the current release, SCOPe 2.08, called d1kcwa6
View in 3D
