Lineage for d2x64b1 (2x64 B:-1-77)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880562Species Xylella fastidiosa [TaxId:160492] [231546] (1 PDB entry)
  8. 2880564Domain d2x64b1: 2x64 B:-1-77 [231547]
    Other proteins in same PDB: d2x64a2, d2x64b2, d2x64c2, d2x64d2, d2x64e2, d2x64f2
    automated match to d4iq1a1
    complexed with cl, gsh

Details for d2x64b1

PDB Entry: 2x64 (more details), 2.3 Å

PDB Description: glutathione-s-transferase from xylella fastidiosa
PDB Compounds: (B:) glutathione-s-transferase

SCOPe Domain Sequences for d2x64b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x64b1 c.47.1.0 (B:-1-77) automated matches {Xylella fastidiosa [TaxId: 160492]}
hhmklyimpgacsladhillrwsgssfdlqfldhqsmkapeylalnpsgavpalqvgdwv
ltqnaailnyitdiapaer

SCOPe Domain Coordinates for d2x64b1:

Click to download the PDB-style file with coordinates for d2x64b1.
(The format of our PDB-style files is described here.)

Timeline for d2x64b1: