SCOPe 2.05: Domain d2x2ya2: 2x2y A:371-465

Lineage for d2x2ya2 (2x2y A:371-465)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Cellulomonas fimi [TaxId:1708] [231539] (1 PDB entry)

8. Domain d2x2ya2: 2x2y A:371-465 [231540]
   Other proteins in same PDB: d2x2ya1, d2x2yb1
   automated match to d2bvta1
   complexed with fmt, mg; mutant

Details for d2x2ya2

PDB Entry: 2x2y, 2.35 Å

PDB Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant

PDB Compounds: (A:) man26a

SCOPe Domain Sequences for d2x2ya2:

Sequence, based on SEQRES records:

>d2x2ya2 b.1.18.0 (A:371-465) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtneva

Sequence, based on observed residues (ATOM records):

>d2x2ya2 b.1.18.0 (A:371-465) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvpttvrvrvggtdvqsvtvevaqtvvdtldlaydgalwwtapwsp
stytvtatattaagtldvtneva

Timeline for d2x2ya2:

• d2x2ya2 first appeared in SCOPe 2.03
  
• d2x2ya2 appears in SCOPe 2.04
  
• d2x2ya2 appears in SCOPe 2.06
  
• d2x2ya2 appears in the current release, SCOPe 2.08