Class b: All beta proteins [48724] (149 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Ceruloplasmin [49559] (1 species) consists of 6 domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry) |
Domain d1kcw_4: 1kcw 554-705 [23154] |
PDB Entry: 1kcw (more details), 3 Å
SCOP Domain Sequences for d1kcw_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcw_4 b.6.1.3 (554-705) Ceruloplasmin {Human (Homo sapiens)} dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte gtfnveclttdhytggmkqkytvnqcrrqsed
Timeline for d1kcw_4: