SCOP 1.71: Domain d1kcw_4: 1kcw 554-705

Lineage for d1kcw_4 (1kcw 554-705)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Ceruloplasmin [49559] (1 species)
   consists of 6 domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)

8. Domain d1kcw_4: 1kcw 554-705 [23154]

Details for d1kcw_4

PDB Entry: 1kcw, 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

SCOP Domain Sequences for d1kcw_4:

Sequence; same for both SEQRES and ATOM records:

>d1kcw_4 b.6.1.3 (554-705) Ceruloplasmin {Human (Homo sapiens)}
dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp
gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte
gtfnveclttdhytggmkqkytvnqcrrqsed

Timeline for d1kcw_4:

• d1kcw_4 first appeared (with stable ids) in SCOP 1.55
  
• d1kcw_4 appears in SCOP 1.69
  
• d1kcw_4 is called d1kcwa4 in SCOP 1.73
  
• d1kcw_4 appears in the current release, SCOPe 2.08, called d1kcwa4