SCOPe 2.03: Domain d2wvjd1: 2wvj D:18-150

Lineage for d2wvjd1 (2wvj D:18-150)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
   N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)

6. Protein automated matches [230352] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230353] (2 PDB entries)

8. Domain d2wvjd1: 2wvj D:18-150 [231523]
   Other proteins in same PDB: d2wvja2, d2wvjb2, d2wvjc2, d2wvjd2, d2wvje2
   automated match to d1xbta1
   complexed with mg, ttp, zn; mutant

Details for d2wvjd1

PDB Entry: 2wvj, 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine

PDB Compounds: (D:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvjd1:

Sequence, based on SEQRES records:

>d2wvjd1 c.37.1.24 (D:18-150) automated matches {Homo sapiens [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records):

>d2wvjd1 c.37.1.24 (D:18-150) automated matches {Homo sapiens [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysalpacllrdvaqeal
gvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvkl
t

Timeline for d2wvjd1:

• d2wvjd1 is new in SCOPe 2.03-stable
  
• d2wvjd1 appears in SCOPe 2.04
  
• d2wvjd1 appears in the current release, SCOPe 2.08