Lineage for d1kcw_1 (1kcw 1-192)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) 
Protein Ceruloplasmin [49559] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry) 
Domain d1kcw_1: 1kcw 1-192 [23151]
Details for d1kcw_1
PDB Entry: 1kcw (more details), 3 Å
PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms
SCOP Domain Sequences for d1kcw_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcw_1 b.6.1.3 (1-192) Ceruloplasmin {Human (Homo sapiens)}
kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
ckkdsldkekek
SCOP Domain Coordinates for d1kcw_1:
Click to download the PDB-style file with coordinates for d1kcw_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kcw_1:
- d1kcw_1 appears in SCOP 1.57
- d1kcw_1 appears in the current release, SCOPe 2.08, called d1kcwa1
View in 3D
