Lineage for d1a65a2 (1a65 A:132-303)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) 
Protein Laccase [49557] (4 species) Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries) 
Domain d1a65a2: 1a65 A:132-303 [23149]
Details for d1a65a2
PDB Entry: 1a65 (more details), 2.23 Å
PDB Description: type-2 cu-depleted laccase from coprinus cinereus
SCOP Domain Sequences for d1a65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a65a2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus)}
phaalydeddentiitladwyhipapsiqgaaqpdatlingkgryvggpaaelsivnveq
gkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftgqrysfvldanq
pvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnpaql
SCOP Domain Coordinates for d1a65a2:
Click to download the PDB-style file with coordinates for d1a65a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a65a2:
- d1a65a2 first appeared (with stable ids) in SCOP 1.55
- d1a65a2 appears in SCOP 1.59
- d1a65a2 appears in SCOP 1.63
- d1a65a2 appears in the current release, SCOPe 2.08
View in 3D
