SCOPe 2.03: Domain d2wspb2: 2wsp B:357-447

Lineage for d2wspb2 (2wsp B:357-447)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [231485] (1 PDB entry)

8. Domain d2wspb2: 2wsp B:357-447 [231488]
   Other proteins in same PDB: d2wspa1, d2wspb1
   automated match to d1hl8a1
   complexed with fuc, fuy

Details for d2wspb2

PDB Entry: 2wsp, 2.65 Å

PDB Description: thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3

PDB Compounds: (B:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2wspb2:

Sequence; same for both SEQRES and ATOM records:

>d2wspb2 b.71.1.0 (B:357-447) automated matches {Thermotoga maritima [TaxId: 243274]}
gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger
lsfknvgknleitvpkklletdsitlvleav

Timeline for d2wspb2:

• d2wspb2 is new in SCOPe 2.03-stable
  
• d2wspb2 appears in SCOPe 2.04
  
• d2wspb2 appears in the current release, SCOPe 2.08