Class b: All beta proteins [48724] (119 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (5 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) |
Protein Laccase [49557] (4 species) consists of three domains of this fold |
Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries) |
Domain d1a65a1: 1a65 A:1-131 [23148] |
PDB Entry: 1a65 (more details), 2.23 Å
SCOP Domain Sequences for d1a65a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a65a1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus)} qivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl rgpmviyddnd
Timeline for d1a65a1: