Lineage for d1a65a1 (1a65 A:1-131)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106913Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 106948Protein Laccase [49557] (1 species)
  7. 106949Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)
  8. 106953Domain d1a65a1: 1a65 A:1-131 [23148]

Details for d1a65a1

PDB Entry: 1a65 (more details), 2.23 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus

SCOP Domain Sequences for d1a65a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a65a1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus)}
qivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
rgpmviyddnd

SCOP Domain Coordinates for d1a65a1:

Click to download the PDB-style file with coordinates for d1a65a1.
(The format of our PDB-style files is described here.)

Timeline for d1a65a1: