Lineage for d2wnre2 (2wnr E:188-270)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663587Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 1663588Protein automated matches [226956] (5 species)
    not a true protein
  7. 1663591Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry)
  8. 1663596Domain d2wnre2: 2wnr E:188-270 [231465]
    Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1
    automated match to d2je6a2
    complexed with po4

Details for d2wnre2

PDB Entry: 2wnr (more details), 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly
PDB Compounds: (E:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2wnre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnre2 d.101.1.0 (E:188-270) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
pvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggegpltrddv
lkavsiavekvpqlieyldksmt

SCOPe Domain Coordinates for d2wnre2:

Click to download the PDB-style file with coordinates for d2wnre2.
(The format of our PDB-style files is described here.)

Timeline for d2wnre2: