SCOPe 2.06: Domain d2wn6a2: 2wn6 A:217-420

Lineage for d2wn6a2 (2wn6 A:217-420)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries)

8. Domain d2wn6a2: 2wn6 A:217-420 [231455]
   automated match to d1giqa2
   complexed with gol, ndp

Details for d2wn6a2

PDB Entry: 2wn6, 1.96 Å

PDB Description: structural basis for substrate recognition in the enzymatic component of adp-ribosyltransferase toxin cdta from clostridium difficile

PDB Compounds: (A:) ADP-ribosyltransferase enzymatic component

SCOPe Domain Sequences for d2wn6a2:

Sequence; same for both SEQRES and ATOM records:

>d2wn6a2 d.166.1.0 (A:217-420) automated matches {Clostridium difficile [TaxId: 1496]}
sldfkddvskgdswgkanyndwsnkltpneladvndymrggytainnylisngpvnnpnp
eldskitnienalkrepiptnltvyrrsgpqefgltltspeydfnklenidafkskwegq
alsypnfistsigsvnmsafakrkivlritipkgspgaylsaipgyageyevllnhgskf
kinkidsykdgtitklivdatlip

Timeline for d2wn6a2:

• d2wn6a2 first appeared in SCOPe 2.03
  
• d2wn6a2 appears in SCOPe 2.05
  
• d2wn6a2 appears in SCOPe 2.07
  
• d2wn6a2 appears in the current release, SCOPe 2.08