Lineage for d2wn7a2 (2wn7 A:217-420)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234169Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries)
  8. 2234179Domain d2wn7a2: 2wn7 A:217-420 [231454]
    automated match to d1giqa2
    complexed with gol, nad

Details for d2wn7a2

PDB Entry: 2wn7 (more details), 2.25 Å

PDB Description: structural basis for substrate recognition in the enzymatic component of adp-ribosyltransferase toxin cdta from clostridium difficile
PDB Compounds: (A:) ADP-ribosyltransferase enzymatic component

SCOPe Domain Sequences for d2wn7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wn7a2 d.166.1.0 (A:217-420) automated matches {Clostridium difficile [TaxId: 1496]}
sldfkddvskgdswgkanyndwsnkltpneladvndymrggytainnylisngpvnnpnp
eldskitnienalkrepiptnltvyrrsgpqefgltltspeydfnklenidafkskwegq
alsypnfistsigsvnmsafakrkivlritipkgspgaylsaipgyageyevllnhgskf
kinkidsykdgtitklivdatlip

SCOPe Domain Coordinates for d2wn7a2:

Click to download the PDB-style file with coordinates for d2wn7a2.
(The format of our PDB-style files is described here.)

Timeline for d2wn7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wn7a1