Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (12 species) not a true protein |
Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries) |
Domain d2wn7a1: 2wn7 A:27-216 [231453] automated match to d1giqa1 complexed with gol, nad |
PDB Entry: 2wn7 (more details), 2.25 Å
SCOPe Domain Sequences for d2wn7a1:
Sequence, based on SEQRES records: (download)
>d2wn7a1 d.166.1.0 (A:27-216) automated matches {Clostridium difficile [TaxId: 1496]} erkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrna isknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdi slyepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidkivrividgkh yikaeasvvs
>d2wn7a1 d.166.1.0 (A:27-216) automated matches {Clostridium difficile [TaxId: 1496]} erkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelrna isknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfkdi slyepgkgdekptpllmhlklprntgmlpytnnvstlieqgysikidkivrividgkhyi kaeasvvs
Timeline for d2wn7a1: