Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (9 species) not a true protein |
Species Clostridium difficile [TaxId:1496] [231449] (5 PDB entries) |
Domain d2wn6a1: 2wn6 A:17-216 [231452] automated match to d1giqa1 complexed with gol, ndp |
PDB Entry: 2wn6 (more details), 1.96 Å
SCOPe Domain Sequences for d2wn6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wn6a1 d.166.1.0 (A:17-216) automated matches {Clostridium difficile [TaxId: 1496]} lkdkekakewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansr ekeykelrnaisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnk lfkqdgfkdislwepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidk ivrividgkhyikaeasvvs
Timeline for d2wn6a1: