Lineage for d2vxra2 (2vxr A:1089-1298)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062372Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2062377Domain d2vxra2: 2vxr A:1089-1298 [231361]
    Other proteins in same PDB: d2vxra1
    automated match to d3btaa2
    complexed with gol, so4

Details for d2vxra2

PDB Entry: 2vxr (more details), 1.9 Å

PDB Description: crystal structure of the botulinum neurotoxin serotype g binding domain
PDB Compounds: (A:) botulinum neurotoxin type g

SCOPe Domain Sequences for d2vxra2:

Sequence, based on SEQRES records: (download)

>d2vxra2 b.42.4.0 (A:1089-1298) automated matches {Clostridium botulinum [TaxId: 1491]}
tntlkdfwgnplrydtqyylfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylg
lrfiikkasnsrninndnivregdyiylnidnisdesyrvyvlvnskeiqtqlflapind
dptfydvlqikkyyekttyncqilcekdtktfglfgigkfvkdygyvwdtydnyfcisqw
ylrriseninklrlgcnwqfipvdegwtel

Sequence, based on observed residues (ATOM records): (download)

>d2vxra2 b.42.4.0 (A:1089-1298) automated matches {Clostridium botulinum [TaxId: 1491]}
tntlkdfwgnplrydtqyylfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylg
lrfiikkasnsrninndnivregdyiylnidnisdesyrvyvlvnskeiqtqlflapind
dptfydvlqikkyyekttyncqilcekdtktfglfgigkfvkdywdtydnyfcisqwylr
riseninklrlgcnwqfipvdegwtel

SCOPe Domain Coordinates for d2vxra2:

Click to download the PDB-style file with coordinates for d2vxra2.
(The format of our PDB-style files is described here.)

Timeline for d2vxra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vxra1