SCOPe 2.04: Domain d2vx2d_: 2vx2 D:

Lineage for d2vx2d_ (2vx2 D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)

8. Domain d2vx2d_: 2vx2 D: [231356]
   automated match to d4k2na_

Details for d2vx2d_

PDB Entry: 2vx2, 2.3 Å

PDB Description: crystal structure of human enoyl coenzyme a hydratase domain-containing protein 3 (echdc3)

PDB Compounds: (D:) enoyl-coa hydratase domain-containing protein 3

SCOPe Domain Sequences for d2vx2d_:

Sequence; same for both SEQRES and ATOM records:

>d2vx2d_ c.14.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prptsarqldgirnivlsnpkkrntlslamlkslqsdilhdadsndlkviiisaegpvfs
sghdlkelteeqgrdyhaevfqtcskvmmhirnhpvpviamvnglataagcqlvascdia
vasdkssfatpgvnvglfcstpgvalaravprkvalemlftgepisaqeallhgllskvv
peaelqeetmriarkiaslsrpvvslgkatfykqlpqdlgtayyltsqamvdnlalrdgq
egitaflqkrkpvwsh

Timeline for d2vx2d_:

• d2vx2d_ first appeared in SCOPe 2.03
  
• d2vx2d_ appears in SCOPe 2.05
  
• d2vx2d_ appears in the current release, SCOPe 2.08