SCOPe 2.03: Domain d2vula_: 2vul A:

Lineage for d2vula_ (2vul A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [231350] (1 PDB entry)

8. Domain d2vula_: 2vul A: [231351]
   automated match to d1igoa_
   complexed with 12p, so4; mutant

Details for d2vula_

PDB Entry: 2vul, 1.9 Å

PDB Description: thermostable mutant of environmentally isolated gh11 xylanase

PDB Compounds: (A:) gh11 xylanase

SCOPe Domain Sequences for d2vula_:

Sequence; same for both SEQRES and ATOM records:

>d2vula_ b.29.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
aqtcltspqtgfhngffysfwkdspgtvnfclleggrytsnwsginnwvggkgwqtgsrr
nitysgsfntpgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydi
yraqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimate
gyqssgssditvs

Timeline for d2vula_:

• d2vula_ is new in SCOPe 2.03-stable
  
• d2vula_ appears in SCOPe 2.04
  
• d2vula_ appears in the current release, SCOPe 2.08