Class b: All beta proteins [48724] (149 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (6 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Ascorbate oxidase [49555] (1 species) consists of three domains of this fold |
Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries) |
Domain d1asob3: 1aso B:339-552 [23135] complexed with cu, nag, oh |
PDB Entry: 1aso (more details), 2.2 Å
SCOP Domain Sequences for d1asob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1asob3 b.6.1.3 (B:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)} ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg vvfaegvekvgriptkalacggtakslinnpknp
Timeline for d1asob3: