Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
Protein automated matches [229100] (3 species) not a true protein |
Domain d2vu9a2: 2vu9 A:1080-1297 [231347] Other proteins in same PDB: d2vu9a1 automated match to d3btaa2 complexed with mg |
PDB Entry: 2vu9 (more details), 1.6 Å
SCOPe Domain Sequences for d2vu9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vu9a2 b.42.4.2 (A:1080-1297) automated matches {Clostridium botulinum [TaxId: 36826]} nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia klvasnwynrqierssrtlgcswefipvddgwgerplq
Timeline for d2vu9a2: