SCOPe 2.06: Domain d2vu9a1: 2vu9 A:875-1079

Lineage for d2vu9a1 (2vu9 A:875-1079)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein automated matches [229097] (4 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:36826] [231344] (1 PDB entry)

8. Domain d2vu9a1: 2vu9 A:875-1079 [231345]
   Other proteins in same PDB: d2vu9a2, d2vu9a3
   automated match to d3btaa1
   complexed with mg

Details for d2vu9a1

PDB Entry: 2vu9, 1.6 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a binding domain in complex with gt1b

PDB Compounds: (A:) botulinum neurotoxin a heavy chain

SCOPe Domain Sequences for d2vu9a1:

Sequence; same for both SEQRES and ATOM records:

>d2vu9a1 b.29.1.6 (A:875-1079) automated matches {Clostridium botulinum [TaxId: 36826]}
dtsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivy
nsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeik
qrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnim
fkldgcrdthryiwikyfnlfdkel

Timeline for d2vu9a1:

• d2vu9a1 first appeared in SCOPe 2.03
  
• d2vu9a1 appears in SCOPe 2.05
  
• d2vu9a1 appears in SCOPe 2.07
  
• d2vu9a1 appears in the current release, SCOPe 2.08