Lineage for d1asob2 (1aso B:130-338)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Ascorbate oxidase, middle domain [418903] (1 species)
    protein consists of three domains of this fold
  7. Species Zucchini (Cucurbita pepo var. medullosa) [TaxId:3663] [419305] (4 PDB entries)
  8. 2771260Domain d1asob2: 1aso B:130-338 [23134]
    Other proteins in same PDB: d1asoa1, d1asoa3, d1asob1, d1asob3
    complexed with cu, nag, oh
    has additional insertions and/or extensions that are not grouped together

Details for d1asob2

PDB Entry: 1aso (more details), 2.2 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms
PDB Compounds: (B:) ascorbate oxidase

SCOPe Domain Sequences for d1asob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1asob2 b.6.1.3 (B:130-338) Ascorbate oxidase, middle domain {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]}
pfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdcsiaakydsn
lepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvveadgnyvqpf
ytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylpnsvsklpts
pppqtpawddfdrsknftyritaamgspk

SCOPe Domain Coordinates for d1asob2:

Click to download the PDB-style file with coordinates for d1asob2.
(The format of our PDB-style files is described here.)

Timeline for d1asob2: