Lineage for d2uyyb2 (2uyy B:430-553)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498233Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1498234Protein automated matches [226851] (26 species)
    not a true protein
  7. 1498292Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)
  8. 1498306Domain d2uyyb2: 2uyy B:430-553 [231338]
    Other proteins in same PDB: d2uyya1, d2uyyb1, d2uyyc1, d2uyyd1
    automated match to d3ckya2
    complexed with k, na7

Details for d2uyyb2

PDB Entry: 2uyy (more details), 2.5 Å

PDB Description: structure of the cytokine-like nuclear factor n-pac
PDB Compounds: (B:) n-pac protein

SCOPe Domain Sequences for d2uyyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyyb2 a.100.1.0 (B:430-553) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgnaakmmlivnmvqgsfmatiaegltlaqvtgqsqqtlldilnqgqlasifldqkcqni
lqgnfkpdfylkyiqkdlrlaialgdavnhptpmaaaanevykrakaldqsdndmsavyr
ayih

SCOPe Domain Coordinates for d2uyyb2:

Click to download the PDB-style file with coordinates for d2uyyb2.
(The format of our PDB-style files is described here.)

Timeline for d2uyyb2: