SCOP 1.55: Domain d1asob1: 1aso B:1-129

Lineage for d1asob1 (1aso B:1-129)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (3 families)

5. Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)

6. Protein Ascorbate oxidase [49555] (1 species)

7. Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)

8. Domain d1asob1: 1aso B:1-129 [23133]

Details for d1asob1

PDB Entry: 1aso, 2.2 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1asob1:

Sequence; same for both SEQRES and ATOM records:

>d1asob1 b.6.1.3 (B:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
vdppqgkke

Timeline for d1asob1:

• d1asob1 appears in SCOP 1.57
  
• d1asob1 appears in the current release, SCOPe 2.08