Lineage for d2v6ja1 (2v6j A:2-135)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872450Species Kokobera virus [TaxId:44024] [231310] (2 PDB entries)
  8. 2872453Domain d2v6ja1: 2v6j A:2-135 [231312]
    automated match to d1yksa1
    mutant

Details for d2v6ja1

PDB Entry: 2v6j (more details), 2.3 Å

PDB Description: kokobera virus helicase: mutant met47thr
PDB Compounds: (A:) RNA helicase

SCOPe Domain Sequences for d2v6ja1:

Sequence, based on SEQRES records: (download)

>d2v6ja1 c.37.1.0 (A:2-135) automated matches {Kokobera virus [TaxId: 44024]}
reltvldlhpgagktrrvlpqlvreavkkrlrtvilaptrvvasetyealrgepirymtp
avqsertgneivdfmchstftmkllqgvrvpnynlyimdeahfldpasvaargyietrvs
mgdagaifmtatpp

Sequence, based on observed residues (ATOM records): (download)

>d2v6ja1 c.37.1.0 (A:2-135) automated matches {Kokobera virus [TaxId: 44024]}
reltvldlhpgagktrrvlpqlvreavkkrlrtvilaptrvvasetyealrgepirymgn
eivdfmchstftmkllqgvrvpnynlyimdeahfldpasvaargyietrvsmgdagaifm
tatpp

SCOPe Domain Coordinates for d2v6ja1:

Click to download the PDB-style file with coordinates for d2v6ja1.
(The format of our PDB-style files is described here.)

Timeline for d2v6ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v6ja2