Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Synechococcus elongatus [TaxId:1140] [231303] (1 PDB entry) |
Domain d2v5hd_: 2v5h D: [231307] Other proteins in same PDB: d2v5hg_, d2v5hh_, d2v5hi_, d2v5hj_, d2v5hk_, d2v5hl_ automated match to d2bufa1 complexed with cl, gol, na, nlg |
PDB Entry: 2v5h (more details), 2.75 Å
SCOPe Domain Sequences for d2v5hd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5hd_ c.73.1.0 (D:) automated matches {Synechococcus elongatus [TaxId: 1140]} agaadrvrilsealpylqqfagrtvvvkyggaamkqeelkeavmrdivflacvgmrpvvv hgggpeinawlgrvgiepqfhnglrvtdadtmevvemvlvgrvnkdivsrinttggravg fcgtdgrlvlarphdqegigfvgevnsvnseviepllergyipvissvaadengqsfnin adtvageiaaalnaeklilltdtrgiledpkrpesliprlnipqsreliaqgivgggmip kvdccirslaqgvraahiidgriphallleiftdagigtmivgsgy
Timeline for d2v5hd_: